AV51877

CPN2 antibody from Sigma-Aldrich
ACBP
No application information provided.

Antibody data

Product number
AV51877
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV51877, RRID:AB_1847190
Product name
Anti-CPN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV51877
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CPN2 with an internal ID of P40056
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTG
SSFLNLSTNIFSNLT
Storage
-20C
Provider Type Product Number
- No reagents -