HPA004732

CPN2 antibody from Sigma-Aldrich
ACBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004732
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004732, RRID:AB_1078561
Product name
Anti-CPN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004732
Antibody type
Polyclonal
Antigen
Carboxypeptidase N subunit 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTD
RLLNIQTYCAGPAYLKGQVVPALNEKQLVCPVTRD
HLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSN
PEGTVVLACDQAQCRWLNVQLSPWQGSLGLQYNAS
QEW
Storage
-20C
Provider Type Product Number
- No reagents -