Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182823 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 24 (ZNF24) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF24 antibody: synthetic peptide directed towards the middle region of human ZNF24
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
CDDDGRTENGALAPKQELPSALESHEVPGTLSMGV
PQIFK YGETCFPKGR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Zinc finger protein 191 deficiency attenuates vascular smooth muscle cell proliferation, migration, and intimal hyperplasia after endovascular arterial injury.
Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB.
Lv L, Zhang J, Wang P, Meng Q, Liang W, Zhang L
Journal of vascular surgery 2014 Feb;59(2):500-9
Journal of vascular surgery 2014 Feb;59(2):500-9
Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB.
Han ZG, Zhang QH, Ye M, Kan LX, Gu BW, He KL, Shi SL, Zhou J, Fu G, Mao M, Chen SJ, Yu L, Chen Z
The Journal of biological chemistry 1999 Dec 10;274(50):35741-8
The Journal of biological chemistry 1999 Dec 10;274(50):35741-8
No comments: Submit comment
No validations: Submit validation data