HPA024062

ZNF24 antibody from Sigma-Aldrich
KOX17, Zfp191, ZNF191, ZSCAN3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024062
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024062, RRID:AB_1859150
Product name
Anti-ZNF24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024062
Antibody type
Polyclonal
Antigen
Zinc finger protein 24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGL
PSSELDAVENQLKWASWELHSLRHCDDDGRTENGA
LAPKQELPSALESHEVPGTLSMGVPQIFKYGETCF
PKGRFERKRNPSRKKQHICDECGKHFS
Storage
-20C
Provider Type Product Number
- No reagents -