HPA007724

PROS1 antibody from Sigma-Aldrich
PROS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007724
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007724, RRID:AB_1079688
Product name
Anti-PROS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007724
Antibody type
Polyclonal
Antigen
Vitamin K-dependent protein S precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQ
FHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALV
SGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRI
QALSLCSDQQSHLEFRVNR
Storage
-20C
Provider Type Product Number
- No reagents -