Antibody data
- Antibody Data
- Antigen structure
- References [36]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001859-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001859-M01, RRID:AB_534844
- Product name
- DYRK1A monoclonal antibody (M01), clone 7D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DYRK1A.
- Antigen sequence
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNP
RQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGA
DREESPMTGVCVQQSPVASS- Isotype
- IgG
- Antibody clone number
- 7D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Rescue of the abnormal skeletal phenotype in Ts65Dn Down syndrome mice using genetic and therapeutic modulation of trisomic Dyrk1a.
DYRK1A overexpression enhances STAT activity and astrogliogenesis in a Down syndrome mouse model.
Low dose EGCG treatment beginning in adolescence does not improve cognitive impairment in a Down syndrome mouse model.
DYRK1A controls the transition from proliferation to quiescence during lymphoid development by destabilizing Cyclin D3.
Molecular rescue of DYRK1A overexpression in cystathionine beta synthase-deficient mouse brain by enriched environment combined with voluntary exercise.
DYRK1A-mediated Cyclin D1 Degradation in Neural Stem Cells Contributes to the Neurogenic Cortical Defects in Down Syndrome.
Overexpression of Dyrk1A is implicated in several cognitive, electrophysiological and neuromorphological alterations found in a mouse model of Down syndrome.
Dyrk1a haploinsufficiency induces diabetes in mice through decreased pancreatic beta cell mass.
cdc-like/dual-specificity tyrosine phosphorylation-regulated kinases inhibitor leucettine L41 induces mTOR-dependent autophagy: implication for Alzheimer's disease.
Prefrontal deficits in a murine model overexpressing the down syndrome candidate gene dyrk1a.
Modelling and rescuing neurodevelopmental defect of Down syndrome using induced pluripotent stem cells from monozygotic twins discordant for trisomy 21.
Plasma DYRK1A as a novel risk factor for Alzheimer's disease.
NGF upregulates the plasminogen activation inhibitor-1 in neurons via the calcineurin/NFAT pathway and the Down syndrome-related proteins DYRK1A and RCAN1 attenuate this effect.
Dyrk1A is dynamically expressed on subsets of motor neurons and in the neuromuscular junction: possible role in Down syndrome.
Mice deficient in cystathionine beta synthase display increased Dyrk1A and SAHH activities in brain.
Hepatocyte-specific Dyrk1a gene transfer rescues plasma apolipoprotein A-I levels and aortic Akt/GSK3 pathways in hyperhomocysteinemic mice.
Triplication of DYRK1A causes retinal structural and functional alterations in Down syndrome.
Expression of trisomic proteins in Down syndrome model systems.
Dyrk1A, a serine/threonine kinase, is involved in ERK and Akt activation in the brain of hyperhomocysteinemic mice.
Environmental enrichment rescues DYRK1A activity and hippocampal adult neurogenesis in TgDyrk1A.
Normalization of Dyrk1A expression by AAV2/1-shDyrk1A attenuates hippocampal-dependent defects in the Ts65Dn mouse model of Down syndrome.
The NAD(+)-dependent protein deacetylase activity of SIRT1 is regulated by its oligomeric status.
Increased dosage of the chromosome 21 ortholog Dyrk1a promotes megakaryoblastic leukemia in a murine model of Down syndrome.
Dyrk1A negatively regulates the actin cytoskeleton through threonine phosphorylation of N-WASP.
Loss of correlations among proteins in brains of the Ts65Dn mouse model of down syndrome.
DYRK1A: a master regulatory protein controlling brain growth.
Altered regulation of tau phosphorylation in a mouse model of down syndrome aging.
Engineering DYRK1A overdosage yields Down syndrome-characteristic cortical splicing aberrations.
Hyperhomocysteinemia-induced Dyrk1a downregulation results in cardiomyocyte hypertrophy in rats.
DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
Green tea polyphenols rescue of brain defects induced by overexpression of DYRK1A.
DYRK1A, a novel determinant of the methionine-homocysteine cycle in different mouse models overexpressing this Down-syndrome-associated kinase.
Negative feedback Inhibition of NFATc1 by DYRK1A regulates bone homeostasis.
Nonprimed and DYRK1A-primed GSK3 beta-phosphorylation sites on MAP1B regulate microtubule dynamics in growing axons.
Effect of hyperhomocysteinemia on the protein kinase DYRK1A in liver of mice.
Sprouty2-mediated inhibition of fibroblast growth factor signaling is modulated by the protein kinase DYRK1A.
Blazek JD, Abeysekera I, Li J, Roper RJ
Human molecular genetics 2015 Oct 15;24(20):5687-96
Human molecular genetics 2015 Oct 15;24(20):5687-96
DYRK1A overexpression enhances STAT activity and astrogliogenesis in a Down syndrome mouse model.
Kurabayashi N, Nguyen MD, Sanada K
EMBO reports 2015 Nov;16(11):1548-62
EMBO reports 2015 Nov;16(11):1548-62
Low dose EGCG treatment beginning in adolescence does not improve cognitive impairment in a Down syndrome mouse model.
Stringer M, Abeysekera I, Dria KJ, Roper RJ, Goodlett CR
Pharmacology, biochemistry, and behavior 2015 Nov;138:70-9
Pharmacology, biochemistry, and behavior 2015 Nov;138:70-9
DYRK1A controls the transition from proliferation to quiescence during lymphoid development by destabilizing Cyclin D3.
Thompson BJ, Bhansali R, Diebold L, Cook DE, Stolzenburg L, Casagrande AS, Besson T, Leblond B, Désiré L, Malinge S, Crispino JD
The Journal of experimental medicine 2015 Jun 1;212(6):953-70
The Journal of experimental medicine 2015 Jun 1;212(6):953-70
Molecular rescue of DYRK1A overexpression in cystathionine beta synthase-deficient mouse brain by enriched environment combined with voluntary exercise.
Souchet B, Latour A, Gu Y, Daubigney F, Paul JL, Delabar JM, Janel N
Journal of molecular neuroscience : MN 2015 Feb;55(2):318-23
Journal of molecular neuroscience : MN 2015 Feb;55(2):318-23
DYRK1A-mediated Cyclin D1 Degradation in Neural Stem Cells Contributes to the Neurogenic Cortical Defects in Down Syndrome.
Najas S, Arranz J, Lochhead PA, Ashford AL, Oxley D, Delabar JM, Cook SJ, Barallobre MJ, Arbonés ML
EBioMedicine 2015 Feb;2(2):120-34
EBioMedicine 2015 Feb;2(2):120-34
Overexpression of Dyrk1A is implicated in several cognitive, electrophysiological and neuromorphological alterations found in a mouse model of Down syndrome.
García-Cerro S, Martínez P, Vidal V, Corrales A, Flórez J, Vidal R, Rueda N, Arbonés ML, Martínez-Cué C
PloS one 2014;9(9):e106572
PloS one 2014;9(9):e106572
Dyrk1a haploinsufficiency induces diabetes in mice through decreased pancreatic beta cell mass.
Rachdi L, Kariyawasam D, Guez F, Aïello V, Arbonés ML, Janel N, Delabar JM, Polak M, Scharfmann R
Diabetologia 2014 May;57(5):960-9
Diabetologia 2014 May;57(5):960-9
cdc-like/dual-specificity tyrosine phosphorylation-regulated kinases inhibitor leucettine L41 induces mTOR-dependent autophagy: implication for Alzheimer's disease.
Fant X, Durieu E, Chicanne G, Payrastre B, Sbrissa D, Shisheva A, Limanton E, Carreaux F, Bazureau JP, Meijer L
Molecular pharmacology 2014 Mar;85(3):441-50
Molecular pharmacology 2014 Mar;85(3):441-50
Prefrontal deficits in a murine model overexpressing the down syndrome candidate gene dyrk1a.
Thomazeau A, Lassalle O, Iafrati J, Souchet B, Guedj F, Janel N, Chavis P, Delabar J, Manzoni OJ
The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 Jan 22;34(4):1138-47
The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 Jan 22;34(4):1138-47
Modelling and rescuing neurodevelopmental defect of Down syndrome using induced pluripotent stem cells from monozygotic twins discordant for trisomy 21.
Hibaoui Y, Grad I, Letourneau A, Sailani MR, Dahoun S, Santoni FA, Gimelli S, Guipponi M, Pelte MF, Béna F, Antonarakis SE, Feki A
EMBO molecular medicine 2014 Feb;6(2):259-77
EMBO molecular medicine 2014 Feb;6(2):259-77
Plasma DYRK1A as a novel risk factor for Alzheimer's disease.
Janel N, Sarazin M, Corlier F, Corne H, de Souza LC, Hamelin L, Aka A, Lagarde J, Blehaut H, Hindié V, Rain JC, Arbones ML, Dubois B, Potier MC, Bottlaender M, Delabar JM
Translational psychiatry 2014 Aug 12;4(8):e425
Translational psychiatry 2014 Aug 12;4(8):e425
NGF upregulates the plasminogen activation inhibitor-1 in neurons via the calcineurin/NFAT pathway and the Down syndrome-related proteins DYRK1A and RCAN1 attenuate this effect.
Stefos GC, Soppa U, Dierssen M, Becker W
PloS one 2013;8(6):e67470
PloS one 2013;8(6):e67470
Dyrk1A is dynamically expressed on subsets of motor neurons and in the neuromuscular junction: possible role in Down syndrome.
Arque G, Casanovas A, Dierssen M
PloS one 2013;8(1):e54285
PloS one 2013;8(1):e54285
Mice deficient in cystathionine beta synthase display increased Dyrk1A and SAHH activities in brain.
Planque C, Dairou J, Noll C, Bui LC, Ripoll C, Guedj F, Delabar JM, Janel N
Journal of molecular neuroscience : MN 2013 May;50(1):1-6
Journal of molecular neuroscience : MN 2013 May;50(1):1-6
Hepatocyte-specific Dyrk1a gene transfer rescues plasma apolipoprotein A-I levels and aortic Akt/GSK3 pathways in hyperhomocysteinemic mice.
Tlili A, Jacobs F, de Koning L, Mohamed S, Bui LC, Dairou J, Belin N, Ducros V, Dubois T, Paul JL, Delabar JM, De Geest B, Janel N
Biochimica et biophysica acta 2013 Jun;1832(6):718-28
Biochimica et biophysica acta 2013 Jun;1832(6):718-28
Triplication of DYRK1A causes retinal structural and functional alterations in Down syndrome.
Laguna A, Barallobre MJ, Marchena MÁ, Mateus C, Ramírez E, Martínez-Cue C, Delabar JM, Castelo-Branco M, de la Villa P, Arbonés ML
Human molecular genetics 2013 Jul 15;22(14):2775-84
Human molecular genetics 2013 Jul 15;22(14):2775-84
Expression of trisomic proteins in Down syndrome model systems.
Spellman C, Ahmed MM, Dubach D, Gardiner KJ
Gene 2013 Jan 10;512(2):219-25
Gene 2013 Jan 10;512(2):219-25
Dyrk1A, a serine/threonine kinase, is involved in ERK and Akt activation in the brain of hyperhomocysteinemic mice.
Abekhoukh S, Planque C, Ripoll C, Urbaniak P, Paul JL, Delabar JM, Janel N
Molecular neurobiology 2013 Feb;47(1):105-16
Molecular neurobiology 2013 Feb;47(1):105-16
Environmental enrichment rescues DYRK1A activity and hippocampal adult neurogenesis in TgDyrk1A.
Pons-Espinal M, Martinez de Lagran M, Dierssen M
Neurobiology of disease 2013 Dec;60:18-31
Neurobiology of disease 2013 Dec;60:18-31
Normalization of Dyrk1A expression by AAV2/1-shDyrk1A attenuates hippocampal-dependent defects in the Ts65Dn mouse model of Down syndrome.
Altafaj X, Martín ED, Ortiz-Abalia J, Valderrama A, Lao-Peregrín C, Dierssen M, Fillat C
Neurobiology of disease 2013 Apr;52:117-27
Neurobiology of disease 2013 Apr;52:117-27
The NAD(+)-dependent protein deacetylase activity of SIRT1 is regulated by its oligomeric status.
Guo X, Kesimer M, Tolun G, Zheng X, Xu Q, Lu J, Sheehan JK, Griffith JD, Li X
Scientific reports 2012;2:640
Scientific reports 2012;2:640
Increased dosage of the chromosome 21 ortholog Dyrk1a promotes megakaryoblastic leukemia in a murine model of Down syndrome.
Malinge S, Bliss-Moreau M, Kirsammer G, Diebold L, Chlon T, Gurbuxani S, Crispino JD
The Journal of clinical investigation 2012 Mar;122(3):948-62
The Journal of clinical investigation 2012 Mar;122(3):948-62
Dyrk1A negatively regulates the actin cytoskeleton through threonine phosphorylation of N-WASP.
Park J, Sung JY, Park J, Song WJ, Chang S, Chung KC
Journal of cell science 2012 Jan 1;125(Pt 1):67-80
Journal of cell science 2012 Jan 1;125(Pt 1):67-80
Loss of correlations among proteins in brains of the Ts65Dn mouse model of down syndrome.
Ahmed MM, Sturgeon X, Ellison M, Davisson MT, Gardiner KJ
Journal of proteome research 2012 Feb 3;11(2):1251-63
Journal of proteome research 2012 Feb 3;11(2):1251-63
DYRK1A: a master regulatory protein controlling brain growth.
Guedj F, Pereira PL, Najas S, Barallobre MJ, Chabert C, Souchet B, Sebrie C, Verney C, Herault Y, Arbones M, Delabar JM
Neurobiology of disease 2012 Apr;46(1):190-203
Neurobiology of disease 2012 Apr;46(1):190-203
Altered regulation of tau phosphorylation in a mouse model of down syndrome aging.
Sheppard O, Plattner F, Rubin A, Slender A, Linehan JM, Brandner S, Tybulewicz VL, Fisher EM, Wiseman FK
Neurobiology of aging 2012 Apr;33(4):828.e31-44
Neurobiology of aging 2012 Apr;33(4):828.e31-44
Engineering DYRK1A overdosage yields Down syndrome-characteristic cortical splicing aberrations.
Toiber D, Azkona G, Ben-Ari S, Torán N, Soreq H, Dierssen M
Neurobiology of disease 2010 Oct;40(1):348-59
Neurobiology of disease 2010 Oct;40(1):348-59
Hyperhomocysteinemia-induced Dyrk1a downregulation results in cardiomyocyte hypertrophy in rats.
Raaf L, Noll C, Cherifi M, Benazzoug Y, Delabar JM, Janel N
International journal of cardiology 2010 Nov 19;145(2):306-7
International journal of cardiology 2010 Nov 19;145(2):306-7
DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
Guo X, Williams JG, Schug TT, Li X
The Journal of biological chemistry 2010 Apr 23;285(17):13223-32
The Journal of biological chemistry 2010 Apr 23;285(17):13223-32
Green tea polyphenols rescue of brain defects induced by overexpression of DYRK1A.
Guedj F, Sébrié C, Rivals I, Ledru A, Paly E, Bizot JC, Smith D, Rubin E, Gillet B, Arbones M, Delabar JM
PloS one 2009;4(2):e4606
PloS one 2009;4(2):e4606
DYRK1A, a novel determinant of the methionine-homocysteine cycle in different mouse models overexpressing this Down-syndrome-associated kinase.
Noll C, Planque C, Ripoll C, Guedj F, Diez A, Ducros V, Belin N, Duchon A, Paul JL, Badel A, de Freminville B, Grattau Y, Bléhaut H, Herault Y, Janel N, Delabar JM
PloS one 2009 Oct 21;4(10):e7540
PloS one 2009 Oct 21;4(10):e7540
Negative feedback Inhibition of NFATc1 by DYRK1A regulates bone homeostasis.
Lee Y, Ha J, Kim HJ, Kim YS, Chang EJ, Song WJ, Kim HH
The Journal of biological chemistry 2009 Nov 27;284(48):33343-51
The Journal of biological chemistry 2009 Nov 27;284(48):33343-51
Nonprimed and DYRK1A-primed GSK3 beta-phosphorylation sites on MAP1B regulate microtubule dynamics in growing axons.
Scales TM, Lin S, Kraus M, Goold RG, Gordon-Weeks PR
Journal of cell science 2009 Jul 15;122(Pt 14):2424-35
Journal of cell science 2009 Jul 15;122(Pt 14):2424-35
Effect of hyperhomocysteinemia on the protein kinase DYRK1A in liver of mice.
Hamelet J, Noll C, Ripoll C, Paul JL, Janel N, Delabar JM
Biochemical and biophysical research communications 2009 Jan 16;378(3):673-7
Biochemical and biophysical research communications 2009 Jan 16;378(3):673-7
Sprouty2-mediated inhibition of fibroblast growth factor signaling is modulated by the protein kinase DYRK1A.
Aranda S, Alvarez M, Turró S, Laguna A, de la Luna S
Molecular and cellular biology 2008 Oct;28(19):5899-911
Molecular and cellular biology 2008 Oct;28(19):5899-911
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in Hela S3 NE.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DYRK1A is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol