Antibody data

Product number
H00001859-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001859-M01, RRID:AB_534844
Product name
DYRK1A monoclonal antibody (M01), clone 7D10
Provider product page
Abnova Corporation - H00001859-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DYRK1A.
Antigen sequence
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNP
RQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGA
DREESPMTGVCVQQSPVASS
Isotype
IgG
Antibody clone number
7D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -