HPA015810

DYRK1A antibody from Sigma-Aldrich
DYRK, DYRK1, MNBH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015810
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015810, RRID:AB_1847921
Product name
Anti-DYRK1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015810
Antibody type
Polyclonal
Antigen
Dual specificity tyrosine-phosphorylation-regulated kinase 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPH
SHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQ
Storage
-20C
Provider Type Product Number
- No reagents -