HPA022141

CDK5RAP3 antibody from Atlas Antibodies
C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022141
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022141, RRID:AB_1846426
Product name
Anti-CDK5RAP3
Provider product page
Atlas Antibodies - HPA022141
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLK
QSQLLALKKELMVQKQQEALEEQAALEPKLDLLLE
KTKELQKLIEADISKRYSGRPVNLMGTSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -