HPA022141

CDK5RAP3 antibody from Sigma-Aldrich
C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022141
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022141, RRID:AB_1846426
Product name
Anti-CDK5RAP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022141
Antibody type
Polyclonal
Antigen
CDK5 regulatory subunit-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLK
QSQLLALKKELMVQKQQEALEEQAALEPKLDLLLE
KTKELQKLIEADISKRYSGRPVNLMGTSL
Storage
-20C
Provider Type Product Number
- No reagents -