HPA022882

CDK5RAP3 antibody from MilliporeSigma / Merck KGaA
C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022882
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA022882, RRID:AB_1846428
Product name
Anti-CDK5RAP3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA022882
Antibody type
Polyclonal
Antigen
CDK5 regulatory subunit-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEA
IDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVY
EWRTGTEPSVVERPHLEELPEQV
Storage
-20C
Provider Type Product Number
- No reagents -