Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182590 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutamate Receptor Interacting Protein 1 (GRIP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRIP1 antibody: synthetic peptide directed towards the N terminal of human GRIP1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDG
ALAVR RQSIPEEFKG- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Transcriptional regulation of human UGT1A1 gene expression: activated glucocorticoid receptor enhances constitutive androstane receptor/pregnane X receptor-mediated UDP-glucuronosyltransferase 1A1 regulation with glucocorticoid receptor-interacting protein 1.
Sugatani J, Nishitani S, Yamakawa K, Yoshinari K, Sueyoshi T, Negishi M, Miwa M
Molecular pharmacology 2005 Mar;67(3):845-55
Molecular pharmacology 2005 Mar;67(3):845-55
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting