HPA002740

TG antibody from Sigma-Aldrich
AITD3, TGN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002740
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002740, RRID:AB_1080277
Product name
Anti-TG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002740
Antibody type
Polyclonal
Antigen
Thyroglobulin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMCSADYADLLQTFQVFILDELTARGFCQIQVKTF
GTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLE
DIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSF
QLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEG
FYQVLTSEASQDGLGCVKCPEGS
Storage
-20C
Provider Type Product Number
- No reagents -