HPA001834

CP antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001834
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001834, RRID:AB_1078502
Product name
Anti-CP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001834
Antibody type
Polyclonal
Antigen
Ceruloplasmin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEG
TFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFY
LGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNV
SNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVER
KAEEEHLGI
Storage
-20C
Provider Type Product Number
- No reagents -