HPA001835

ITIH4 antibody from Sigma-Aldrich
H4P, IHRP, ITIHL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001835
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001835, RRID:AB_1079432
Product name
Anti-ITIH4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001835
Antibody type
Polyclonal
Antigen
Inter-alpha-trypsin inhibitor heavy chain H4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPE
HVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGL
LLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSS
HVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDH
Storage
-20C
Provider Type Product Number
- No reagents -