HPA002036

F5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002036, RRID:AB_1078787
Product name
Anti-F5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002036
Antibody type
Polyclonal
Antigen
Coagulation factor V precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIE
IIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNIN
SSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYS
EFVQRETDIEDSDDIPEDTT
Storage
-20C
Provider Type Product Number
- No reagents -