HPA018460

DSCR4 antibody from Sigma-Aldrich
DCRB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018460
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018460, RRID:AB_1847873
Product name
Anti-DSCR4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018460
Antibody type
Polyclonal
Antigen
Down syndrome critical region protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDP
ASASPLHREEKILPKVCNIVSCLSFSLPASPTDSG
LASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSD
GR
Storage
-20C
Provider Type Product Number
- No reagents -