HPA003825

F12 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003825
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003825, RRID:AB_1078790
Product name
Anti-F12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003825
Antibody type
Polyclonal
Antigen
Coagulation factor XII precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPK
KVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTG
NHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQ
CKGPDA
Storage
-20C
Provider Type Product Number
- No reagents -