HPA005825

SERPINF1 antibody from MilliporeSigma / Merck KGaA
EPC-1, PEDF, PIG35
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005825
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005825, RRID:AB_1079921
Product name
Anti-SERPINF1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005825
Antibody type
Polyclonal
Antigen
Pigment epithelium-derived factor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSP
LSVATALSALSLGAEQRTESIIHRALYYDLISSPD
IHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKS
SFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQ
MKGKL
Storage
-20C
Provider Type Product Number
- No reagents -