HPA001557

AGT antibody from Sigma-Aldrich
SERPINA8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001557
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001557, RRID:AB_1078111
Product name
Anti-AGT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001557
Antibody type
Polyclonal
Antigen
Angiotensinogen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLD
TEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGA
TVLSPTAVFGTLASLYLGALDHTADRLQAILGVPW
KDKNCTSRLDAHKVLSALQAVQGLLVAQG
Storage
-20C
Provider Type Product Number
- No reagents -