Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001522 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001522, RRID:AB_1079285
- Product name
- Anti-LUM
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKL
KSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQ
WLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNL
TESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Lumican and versican are associated with good outcome in stage II and III colon cancer.
de Wit M, Belt EJ, Delis-van Diemen PM, Carvalho B, Coupé VM, Stockmann HB, Bril H, Beliën JA, Fijneman RJ, Meijer GA
Annals of surgical oncology 2013 Dec;20 Suppl 3(Suppl 3):S348-59
Annals of surgical oncology 2013 Dec;20 Suppl 3(Suppl 3):S348-59
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows moderate to strong cytoplasmic positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in dermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN