HPA001522

LUM antibody from Atlas Antibodies
LDC, SLRR2D
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001522
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001522, RRID:AB_1079285
Product name
Anti-LUM
Provider product page
Atlas Antibodies - HPA001522
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKL
KSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQ
WLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNL
TESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -