HPA001522

LUM antibody from Sigma-Aldrich
LDC, SLRR2D
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001522
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001522, RRID:AB_1079285
Product name
Anti-LUM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001522
Antibody type
Polyclonal
Antigen
Lumican precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKL
KSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQ
WLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNL
TESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF
Storage
-20C
Provider Type Product Number
- No reagents -