HPA001523

HSPD1 antibody from Atlas Antibodies
GroEL, HSP60, SPG13
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001523
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001523, RRID:AB_611534
Product name
Anti-HSPD1
Provider product page
Atlas Antibodies - HPA001523
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RVLAPHLTRAYAKDVKFGADARALMLQGVDLLADA
VAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSID
LKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -