HPA001523

HSPD1 antibody from Sigma-Aldrich
GroEL, HSP60, SPG13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001523
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001523, RRID:AB_1079028
Product name
Anti-HSPD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001523
Antibody type
Polyclonal
Antigen
60 kDa heat shock protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVLAPHLTRAYAKDVKFGADARALMLQGVDLLADA
VAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSID
LKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAEL
Storage
-20C
Provider Type Product Number
- No reagents -