HPA024814

LONRF1 antibody from Sigma-Aldrich
FLJ23749, RNF191
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024814
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024814, RRID:AB_1853235
Product name
Anti-LONRF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024814
Antibody type
Polyclonal
Antigen
LON peptidase N-terminal domain and RING finger protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIP
EELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNC
Storage
-20C
Provider Type Product Number
- No reagents -