Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405953 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PPP1R13B antibody: synthetic peptide directed towards the middle region of human PPP1R13B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHH
HIVKF LLDFGVNVNA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ASPP1, a common activator of TP53, is inactivated by aberrant methylation of its promoter in acute lymphoblastic leukemia.
Agirre X, Román-Gómez J, Jiménez-Velasco A, Garate L, Montiel-Duarte C, Navarro G, Vázquez I, Zalacain M, Calasanz MJ, Heiniger A, Torres A, Minna JD, Prósper F
Oncogene 2006 Mar 23;25(13):1862-70
Oncogene 2006 Mar 23;25(13):1862-70
No comments: Submit comment
No validations: Submit validation data