HPA006394

PPP1R13B antibody from Sigma-Aldrich
ASPP1, KIAA0771, p53BP2-like, p85
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006394
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006394, RRID:AB_1079668
Product name
Anti-PPP1R13B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006394
Antibody type
Polyclonal
Antigen
Apoptosis-stimulating of p53 protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGT
LADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSS
DANDNELPSPEPEELICPQTTHQTAEPAEDNNNNV
ATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHP
PATSTNK
Storage
-20C
Provider Type Product Number
- No reagents -