Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309714 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-alpha-2-HS-Glycoprotein (AHSG) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AHSG antibody: synthetic peptide directed towards the N terminal of human AHSG
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAI
DYINQ NLPWGYKHTL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Inside human aortic stenosis: a proteomic analysis of plasma.
Association between human fetuin-A and the metabolic syndrome: data from the Heart and Soul Study.
Gil-Dones F, Darde VM, Alonso-Orgaz S, Lopez-Almodovar LF, Mourino-Alvarez L, Padial LR, Vivanco F, Barderas MG
Journal of proteomics 2012 Feb 16;75(5):1639-53
Journal of proteomics 2012 Feb 16;75(5):1639-53
Association between human fetuin-A and the metabolic syndrome: data from the Heart and Soul Study.
Ix JH, Shlipak MG, Brandenburg VM, Ali S, Ketteler M, Whooley MA
Circulation 2006 Apr 11;113(14):1760-7
Circulation 2006 Apr 11;113(14):1760-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting