HPA001525

AHSG antibody from Sigma-Aldrich
A2HS, FETUA, HSGA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001525
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001525, RRID:AB_1078849
Product name
Anti-AHSG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001525
Antibody type
Polyclonal
Antigen
alpha-2-HS-glycoprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKH
TLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLD
PTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVV
YAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHA
AKAALA
Storage
-20C
Provider Type Product Number
- No reagents -