HPA021777

RBM48 antibody from Atlas Antibodies
C7orf64, DKFZp564O0523, HSPC304
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021777
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021777, RRID:AB_1845763
Product name
Anti-RBM48
Provider product page
Atlas Antibodies - HPA021777
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAY
VVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEM
SGF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -