HPA025306

RBM48 antibody from Atlas Antibodies
C7orf64, DKFZp564O0523, HSPC304
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025306
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025306, RRID:AB_1845764
Product name
Anti-RBM48
Provider product page
Atlas Antibodies - HPA025306
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VYTINLESQYLLIQGVPAVGVMKELVERFALYGAI
EQYNALDEYPAEDFTEVYLI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -