Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310102 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chromosome 7 Open Reading Frame 64 (C7orf64) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DKFZP564O0523 antibody: synthetic peptide directed towards the C terminal of human DKFZP564O0523
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTAN
LIRHK LKEVISSVPK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A human protein-protein interaction network: a resource for annotating the proteome.
Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE
Cell 2005 Sep 23;122(6):957-68
Cell 2005 Sep 23;122(6):957-68
No comments: Submit comment
No validations: Submit validation data