HPA021777

RBM48 antibody from Sigma-Aldrich
C7orf64, DKFZp564O0523, HSPC304
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021777
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021777, RRID:AB_1845763
Product name
Anti-C7orf64 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021777
Antibody type
Polyclonal
Antigen
UPF0712 protein C7orf64 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAY
VVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEM
SGF
Storage
-20C
Provider Type Product Number
- No reagents -