Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001526 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001526, RRID:AB_1078959
- Product name
- Anti-GC
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCC
QEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVC
DPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLK
SLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQE
LCAD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Gene expression profiling reveals GC and CEACAM1 as new tools in the diagnosis of lung carcinoids.
Toffalorio F, Belloni E, Barberis M, Bucci G, Tizzoni L, Pruneri G, Fumagalli C, Spitaleri G, Catania C, Melotti F, Pelicci PG, Spaggiari L, De Pas T
British journal of cancer 2014 Mar 4;110(5):1244-9
British journal of cancer 2014 Mar 4;110(5):1244-9
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-GC antibody HPA001526 (A) shows similar pattern to independent antibody HPA019855 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN