HPA001526

GC antibody from Atlas Antibodies
DBP, hDBP, VDBP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001526
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001526, RRID:AB_1078959
Product name
Anti-GC
Provider product page
Atlas Antibodies - HPA001526
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCC
QEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVC
DPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLK
SLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQE
LCAD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -