HPA001526

GC antibody from Sigma-Aldrich
DBP, hDBP, VDBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001526
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001526, RRID:AB_1078959
Product name
Anti-GC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001526
Antibody type
Polyclonal
Antigen
Vitamin D-binding protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCC
QEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVC
DPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLK
SLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQE
LCAD
Storage
-20C
Provider Type Product Number
- No reagents -