HPA023972

DHRS4 antibody from Atlas Antibodies
FLJ11008, humNRDR, SCAD-SRL, SDR-SRL, SDR25C2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023972
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023972, RRID:AB_1854890
Product name
Anti-DHRS4
Provider product page
Atlas Antibodies - HPA023972
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPR
NIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLR
IRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG
T
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -