HPA023972

DHRS4 antibody from Sigma-Aldrich
FLJ11008, humNRDR, SCAD-SRL, SDR-SRL, SDR25C2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023972
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023972, RRID:AB_1854890
Product name
Anti-DHRS4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023972
Antibody type
Polyclonal
Antigen
Dehydrogenase/reductase SDR family member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPR
NIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLR
IRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG
T
Storage
-20C
Provider Type Product Number
- No reagents -