Antibody data

Product number
H00000350-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000350-M01A, RRID:AB_1016692
Product name
APOH monoclonal antibody (M01A), clone 3F10
Provider product page
Abnova Corporation - H00000350-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant APOH.
Antigen sequence
DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKK
ATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEK
KCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDAS
DVKPC
Isotype
IgM
Antibody clone number
3F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -