HPA001654

APOH antibody from Atlas Antibodies
B2G1, BG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001654
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001654, RRID:AB_1078181
Product name
Anti-APOH
Provider product page
Atlas Antibodies - HPA001654
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFG
CHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPV
KKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNK
EKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTD
ASDVK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -