HPA003732
APOH antibody from Atlas Antibodies
B2G1, BG
Validated within the Antibodypedia Validation Initative
Antibody data
- Product number
- HPA003732
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003732, RRID:AB_611307
- Product name
- Anti-APOH
- Provider product page
- Atlas Antibodies - HPA003732
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINT
LKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCN
TGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPS
IPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMF
GNDTITC
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424960)
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-APOH antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows extra-cellular positivity in blood vessels and strong granular cytoplasmic positivity in cells of renal tubules.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-APOH antibody HPA003732.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung using Anti-APOH antibody HPA003732.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-APOH antibody HPA003732.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-APOH antibody HPA003732.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human colon, kidney, lung and lymph node using Anti-APOH antibody HPA003732 (A) shows similar protein distribution across tissues to independent antibody HPA001654 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA001654
- Antibody provider
- Atlas Antibodies
- Independent Antibody Method
- ANTIBODY
- Show more
Enhanced validation
