HPA003732

APOH antibody from Sigma-Aldrich
B2G1, BG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003732
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003732, RRID:AB_1078183
Product name
Anti-APOH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003732
Antibody type
Polyclonal
Antigen
beta2-Glycoprotein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINT
LKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCN
TGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPS
IPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMF
GNDTITC
Storage
-20C
Provider Type Product Number
- No reagents -