H00025851-B01

TECPR1 antibody from Abnova Corporation
DKFZP434B0335, FLJ23419, FLJ90593, KIAA1358

Antibody data

Product number
H00025851-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025851-B01, RRID:AB_1204272
Product name
DKFZP434B0335 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00025851-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human DKFZP434B0335 protein.
Antigen sequence
MPNSVLWAVDLFGRVYTLSTAGQYWEMCKDSQLEF
KRVSATTQCCWGIACDNQVYVYVCASDVPIRRREE
AYENQRWNPMGGFCEKLLLSDRWGWSDVSGLQHRP
LDRVALPSPHWEWESDWYVDENFGGEPTEKGGWTY
AIDFPATYTKDKKWNSCVRRRKWIRYRRYKSRDIW
AKIPSKDDPKELPDPFNDLSVGGWEITEEPVGRLS
VWAVSLQGKVWYREDVSHSNPEGSSWSLLDTPGEV
VQISCGPHDLLWATLWEGQALVREGINRSNPKGSS
WSIVEPPGSENGVMHISVGVSVVWAVTKDWKVWFR
RGVNSHNPCGTSWIEMVGEMTMVNVGMNDQVWGIG
CEDRAVYFRQGVTPSELSGKTWKAIIAARECDRSH
SGSSSSLLSAGCFFGDEVRGSGESAPSDTDASSEV
ERPGPGQILPAEPLDDSKNATGNSASGLGAGRTAE
DTVEDACPAEGSREARPNTHPGPAPTPAELPWTNI
DLKEAKKVPSHSAAGFPETTSLSSLGLLPLGLEEP
YGVDDHPLWAWVSGGGCVVEACAMPRWFTVQAGLS
SSVHMLSLSITPAQTAAWRKQIFQQLTERTKRELE
NFRHYEQAVEQSVWVKTGALQWWCDWKPHKWVDVR
LALEQFTGHDGVRDSILFIYYVVHEEKKYIHIFLN
EVVALVPVLNETKHSFALYTPERTRQRWPVRLAAA
TEQDMNDWLALLSLSCCESRKVQGRPSPQAIWSIT
CKGDIFVSEPSPDLEAHEHPLPCDQMFWRQMGGHL
RMVEANSRGVVWGIGYDHTAWVYTGGYGGGCFQGL
ASSTSNIYTQSDVKCVHIYENQRWNPVTGYTSRGL
PTDRYMWSDASGLQECTKAGTKPPSLQWAWVSDWF
VDFSVPGGTDQEGWQYASDFPASYHGSKTMKDFVR
RRCWARKCKLVTSGPWLEVPPIALRDVSIIPESPG
AEGSGHSIALWAVSDKGDVLCRLGVSELNPAGSSW
LHVGTDQPFASISIGACYQVWAVARDGSAFYRGSV
YPSQPAGDCWYHIPSPPRQRLKQVSAGQTSVYALD
ENGNLWYRQGITPSYPQGSSWEHVSNNVCRVSVGP
LDQVWVIANKVQGSHSLSRGTVCHRTGVQPHEPKG
HGWDYGIGGGWDHISVRANATRAPRSSSQEQEPSA
PPEAHGPVCC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -