HPA018885

APOL1 antibody from Sigma-Aldrich
APOL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018885
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018885, RRID:AB_1844953
Product name
Anti-APOL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018885
Antibody type
Polyclonal
Antigen
Apolipoprotein-L1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVP
HASASRPRVTEPISAESGEQVERVNEPSILEMSRG
VKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSET
AEELKKVAQELEEKLNILNN
Storage
-20C
Provider Type Product Number
- No reagents -