Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018885 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018885, RRID:AB_1844953
- Product name
- Anti-APOL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVP
HASASRPRVTEPISAESGEQVERVNEPSILEMSRG
VKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSET
AEELKKVAQELEEKLNILNN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references APOL1 null alleles from a rural village in India do not correlate with glomerulosclerosis.
APOL1 localization in normal kidney and nondiabetic kidney disease.
Johnstone DB, Shegokar V, Nihalani D, Rathore YS, Mallik L, Ashish, Zare V, Ikizler HO, Powar R, Holzman LB
PloS one 2012;7(12):e51546
PloS one 2012;7(12):e51546
APOL1 localization in normal kidney and nondiabetic kidney disease.
Madhavan SM, O'Toole JF, Konieczkowski M, Ganesan S, Bruggeman LA, Sedor JR
Journal of the American Society of Nephrology : JASN 2011 Nov;22(11):2119-28
Journal of the American Society of Nephrology : JASN 2011 Nov;22(11):2119-28
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-431 and MCF-7 using Anti-APOL1 antibody. Corresponding APOL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows moderate to strong positivity in plasma in blood vessels.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong positivity in plasma in blood vessels.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
- Sample type
- HUMAN