HPA001497

AMBP antibody from Atlas Antibodies
EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI

Antibody data

Product number
HPA001497
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001497, RRID:AB_1078144
Product name
Anti-AMBP
Provider product page
Atlas Antibodies - HPA001497
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCM
GMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKE
CLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGK
CVLFPYGGCQGNGNKFYSEKECRE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.