HPA001520

ATP5B antibody from Atlas Antibodies
ATPSB
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA001520
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001520, RRID:AB_611326
Product name
Anti-ATP5B
Provider product page
Atlas Antibodies - HPA001520
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILN
ALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGL
VRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDE
RGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKV
VD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -