HPA001528

ATP5F1B antibody from Atlas Antibodies
ATP5B, ATPSB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001528
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001528, RRID:AB_1078242
Product name
Anti-ATP5B
Provider product page
Atlas Antibodies - HPA001528
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEV
SALLGRIPSAVGYQPTLATDMGTMQERITTTKKGS
ITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRA
IAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -