Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019614 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-AHRR
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATR
GYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKD
SGCEGAADGCVPSQVWLGASDRSHPATF- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Genome-wide mapping and analysis of aryl hydrocarbon receptor (AHR)- and aryl hydrocarbon receptor repressor (AHRR)-binding sites in human breast cancer cells
Aryl Hydrocarbon Receptor Repressor and TiPARP (ARTD14) Use Similar, but also Distinct Mechanisms to Repress Aryl Hydrocarbon Receptor Signaling
Yang S, Ahmed S, Satheesh S, Matthews J
Archives of Toxicology 2017;92(1):225-240
Archives of Toxicology 2017;92(1):225-240
Aryl Hydrocarbon Receptor Repressor and TiPARP (ARTD14) Use Similar, but also Distinct Mechanisms to Repress Aryl Hydrocarbon Receptor Signaling
MacPherson L, Ahmed S, Tamblyn L, Krutmann J, Förster I, Weighardt H, Matthews J
International Journal of Molecular Sciences 2014;15(5):7939-7957
International Journal of Molecular Sciences 2014;15(5):7939-7957
No comments: Submit comment
No validations: Submit validation data