Antibody data

Product number
H00057491-M01
Provider
Abnova Corporation
Product name
AHRR monoclonal antibody (M01), clone 5G11
Provider product page
Abnova Corporation - H00057491-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AHRR.
Antigen sequence
RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQ
LCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATH
SQGMVPGMLPKSALATLVPPQASGCTFLP
Isotype
IgG
Antibody clone number
5G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.