HPA019614

AHRR antibody from Sigma-Aldrich
AHH, AHHR, bHLHe77, KIAA1234
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019614
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019614, RRID:AB_1855109
Product name
Anti-PDCD6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019614
Antibody type
Polyclonal
Antigen
Programmed cell death protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATR
GYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKD
SGCEGAADGCVPSQVWLGASDRSHPATF
Storage
-20C
Provider Type Product Number
- No reagents -