HPA003020

SPARC antibody from Sigma-Aldrich
ON
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003020
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003020, RRID:AB_1079531
Product name
Anti-SPARC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003020
Antibody type
Polyclonal
Antigen
SPARC precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEALPDETEVVEETVAEVTEVSVGANPVQVEVGEF
DDGAEETEEEVVAENPCQNHHCKHGKVCELDENNT
PMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHF
FATKCTLEGTKKGHKLHLDY
Storage
-20C
Provider Type Product Number
- No reagents -